Protein Info for DZA65_RS09160 in Dickeya dianthicola ME23

Annotation: DNA-binding protein YbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF02885: Glycos_trans_3N" amino acids 5 to 68 (64 residues), 46 bits, see alignment E=1.8e-16

Best Hits

Swiss-Prot: 64% identical to YBIB_ECOLI: Uncharacterized protein YbiB (ybiB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_02892)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase like (EC 2.4.2.18)" (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.18

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XW59 at UniProt or InterPro

Protein Sequence (322 amino acids)

>DZA65_RS09160 DNA-binding protein YbiB (Dickeya dianthicola ME23)
MDYTRIIKEVGRGKNHARDLDQGTAYQLYSQILNDQVPELELGGLLIAFRIKGESEAEMR
GFYQAMSEQTLRLSAPAGGPMPVVIPSYNGARKQANLTPLLALLLHRLGLPVVVHGVSRD
PSRVTSEAIFRELGIAPVSDAQAAQQRLDRGEPVFMPVSLLCPAIERQLDLRWRMGVRNS
AHTLAKLATPFDESAALRLASVSHPEYVDRVGTFFEDINGRALLMHGTEGEVYANPQRCP
EIHFIREQRRDILQWRQDIALDSAALPSAKEAAATARWTEACLAGEQPIPQAIRLQLACC
LVGSGEAASMEQASSTVQKRLG