Protein Info for DZA65_RS09125 in Dickeya dianthicola ME23

Annotation: D-alanyl-D-alanine endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00768: Peptidase_S11" amino acids 36 to 264 (229 residues), 261.1 bits, see alignment E=1.4e-81 PF13354: Beta-lactamase2" amino acids 38 to 198 (161 residues), 44 bits, see alignment E=2.5e-15

Best Hits

Swiss-Prot: 74% identical to PBP7_SHIFL: D-alanyl-D-alanine endopeptidase (pbpG) from Shigella flexneri

KEGG orthology group: K07262, D-alanyl-D-alanine endopeptidase (penicillin-binding protein 7) [EC: 3.4.21.-] (inferred from 96% identity to ddd:Dda3937_02899)

MetaCyc: 74% identical to peptidoglycan DD-endopeptidase PbpG (Escherichia coli K-12 substr. MG1655)
3.4.-.-

Predicted SEED Role

"Murein-DD-endopeptidase (EC 3.4.99.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.99.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.- or 3.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XX05 at UniProt or InterPro

Protein Sequence (317 amino acids)

>DZA65_RS09125 D-alanyl-D-alanine endopeptidase (Dickeya dianthicola ME23)
MNKKFRLSVVSLLLLSAPVWFTPQAAAKTPATQHVAARQEIASGSAMVVDLRNNEVLYSA
NPDVVVPIASVTKLMTAMVVLDANQPLDEHISVDISQTKEMNGVYSRVRLGSEISRHDML
LLALMSSENRAAASLAHHYRGGYQAFIAAMNAKARALGMTHTRYVEPTGLSTSNVSTARD
LTKLLIASKQYPLLSQLSTSHEKTAVFTQPSYSLPFRNTNHLIYRQDWNIQLTKTGFTNQ
AGHCLVMRTVINGRPVSLVVLDAFGKFTHFADANRLRNWLETGKVSPVPEAALSYKKQKS
LASRQSHSADVTAAVDE