Protein Info for DZA65_RS09120 in Dickeya dianthicola ME23

Annotation: class IV adenylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 TIGR00318: putative adenylyl cyclase CyaB" amino acids 9 to 177 (169 residues), 61.5 bits, see alignment E=4.7e-21 PF01928: CYTH" amino acids 9 to 173 (165 residues), 78.4 bits, see alignment E=3.2e-26

Best Hits

Swiss-Prot: 47% identical to CYAB_AERHY: Adenylate cyclase CyaB (cyaB) from Aeromonas hydrophila

KEGG orthology group: K05873, adenylate cyclase, class 2 [EC: 4.6.1.1] (inferred from 94% identity to ddd:Dda3937_02901)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XX08 at UniProt or InterPro

Protein Sequence (179 amino acids)

>DZA65_RS09120 class IV adenylate cyclase (Dickeya dianthicola ME23)
MHEHFRGKYEVELKFRIQDISAFRENLFSHHPESFVFENKENDIYYDSAEKALGHQNISM
LLRRMAPSGIKLWIVKGPRTGRCEAVNVESCDMTDSMLRTLGFLPIFEVNKTRSIYFLDR
FHITLDYIESLGHFVEITCMTEDEAELDILGERCTDCGLRLGLSMDSIETRSYRQLLGY