Protein Info for DZA65_RS09065 in Dickeya dianthicola ME23

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 PF00005: ABC_tran" amino acids 26 to 167 (142 residues), 100 bits, see alignment E=4.5e-32 amino acids 348 to 491 (144 residues), 103 bits, see alignment E=5.5e-33

Best Hits

Swiss-Prot: 73% identical to YBHF_SHIFL: Probable multidrug ABC transporter ATP-binding protein YbhF (ybhF) from Shigella flexneri

KEGG orthology group: K01990, ABC-2 type transport system ATP-binding protein (inferred from 97% identity to ddd:Dda3937_04011)

MetaCyc: 73% identical to ABC exporter ATP binding subunit YbhF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-366 [EC: 7.6.2.2]

Predicted SEED Role

"ABC transporter multidrug efflux pump, fused ATP-binding domains"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CSL8 at UniProt or InterPro

Protein Sequence (583 amino acids)

>DZA65_RS09065 ABC transporter ATP-binding protein (Dickeya dianthicola ME23)
MTSDPPLIRLDALEKRFDGMTKPALAQLSAEIRAGAVTGLVGPDGAGKTTLMRMLAGLLT
PSAGAIRVLGLDPIADDRQLHARLGYMPQKFGLYEDLTVMENLTLYADLRGITGDIRRAT
FDRLLQFTDLTRFTTRLAGKLSGGMKQKLGLACTLLGQPGVLLLDEPGVGVDPISRRELW
RMVHELADDGMLILWSTSYLDEAEQCRDVLLLNEGELLYRGAPADLTQRMAGRCLLLDQP
DSNHRRLLQQALRQPQVSDGVIQGRYVRLMLKPQADRAALLHTLGLPPDSVQDAAPRFED
AFIDLLGGGPSATSSLAAILPQLDTHRGETVIEARNLTKKFGDFAATDRVNFQVRRGEIF
GLLGPNGAGKSTTFRMMCGLLTPTDGQALVLDMDLKTRSGRARQHLGYMAQKFSLYGNLT
VEQNLRFFSGVYGLRGQHQQDKVDSMAQAFNFRPIFQQTPDALPFGFRQRLALACALMHE
PDILFLDEPTSGVDPFTRREFWQHINGMVDKGVTVMVTTHFMDEAEYCDRIGLVYRGRLI
ASGTPDDLKRQAASDDTPEPTMEQAFIALVQAYDQEAEHAAAH