Protein Info for DZA65_RS09040 in Dickeya dianthicola ME23

Annotation: Bax inhibitor-1/YccA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details PF01027: Bax1-I" amino acids 20 to 232 (213 residues), 213.8 bits, see alignment E=1.2e-67

Best Hits

Swiss-Prot: 74% identical to YBHL_ECOL6: Inner membrane protein YbhL (ybhL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06890, (no description) (inferred from 98% identity to ddc:Dd586_2465)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D1B3 at UniProt or InterPro

Protein Sequence (236 amino acids)

>DZA65_RS09040 Bax inhibitor-1/YccA family protein (Dickeya dianthicola ME23)
MDRFPRSNGSIVQQASTGLQTYMAQVYGWMTCGLLLTAFVAWYAANTPAVLQLVFSSKIT
FYGLVIAQLGLVFVLSGMVHRLSGGVATTLFMLYSALTGLTLSSIFIVYSGESIASTFVI
TGGMFGAMSLYGYVTKRDLTGMGSMLFMALIGILLATLVNFWLKSEGLQLAITYIGVLVF
VGLTAYDTQKLKNIGEELSVDDRDSFRKYSIMGALTLYLDFINLFLMLLRLFGSRR