Protein Info for DZA65_RS08970 in Dickeya dianthicola ME23

Annotation: 8-amino-7-oxononanoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR00858: 8-amino-7-oxononanoate synthase" amino acids 20 to 380 (361 residues), 463.3 bits, see alignment E=2.2e-143 PF00155: Aminotran_1_2" amino acids 41 to 380 (340 residues), 209.8 bits, see alignment E=1.4e-65 PF00266: Aminotran_5" amino acids 74 to 210 (137 residues), 25.2 bits, see alignment E=1.5e-09 PF01041: DegT_DnrJ_EryC1" amino acids 84 to 214 (131 residues), 22.5 bits, see alignment E=1.2e-08

Best Hits

Swiss-Prot: 73% identical to BIOF_PECAS: 8-amino-7-oxononanoate synthase (bioF) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00652, 8-amino-7-oxononanoate synthase [EC: 2.3.1.47] (inferred from 94% identity to ddd:Dda3937_03749)

MetaCyc: 67% identical to 8-amino-7-oxononanoate synthase (Escherichia coli K-12 substr. MG1655)
8-amino-7-oxononanoate synthase. [EC: 2.3.1.47]; 2.3.1.47 [EC: 2.3.1.47]

Predicted SEED Role

"8-amino-7-oxononanoate synthase (EC 2.3.1.47)" in subsystem Biotin biosynthesis (EC 2.3.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWX1 at UniProt or InterPro

Protein Sequence (384 amino acids)

>DZA65_RS08970 8-amino-7-oxononanoate synthase (Dickeya dianthicola ME23)
MDWQQRIDQALAQRQAENAYRVRVSNDGGSGRWLVRQPHRYLNFSCNDYLGLSQHPAIVR
AWQQGAERYGVGSGGSGHVTGYTTAHEQLEQQLADWLGYDRALLLISGFAANQAVVTALL
TEGDRVLADRLSHASLLEAASLSPATLRRFHHNQPDSLQQLLEKPVSGQTLVVTEGVFSM
DGDTAPLAALHQRCREHGAWLMVDDAHGIGTVGEQGRGCSWQQAVKPELLIVTFGKAFGV
SGAAVLCSQPVAEYLLQFARHLIYSTAMPPAQACALDAALTVVRGADGDARREALAQRVR
HFRDGAAGLPFRLLASASAIQPLIVGDNAWALALAQQLRAQGLWVNAIRPPTVPSGTARL
RITLTASHQPEDIDRLLEVLYDAG