Protein Info for DZA65_RS08940 in Dickeya dianthicola ME23

Annotation: cytidine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01355: cytidine deaminase
  • amino acids 29 to 283 (255 residues), 283.6 bits, E=8.2e-89
• PF00383: dCMP_cyt_deam_1
  • amino acids 59 to 140 (82 residues), 46.9 bits, E=2.1e-16
• PF08211: dCMP_cyt_deam_2
  • amino acids 157 to 277 (121 residues), 161.5 bits, E=1.2e-51

Best Hits

Swiss-Prot: 68% identical to CDD_PECCP: Cytidine deaminase (cdd) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 93% identity to ddd:Dda3937_03742)

MetaCyc: 62% identical to cytidine/deoxycytidine deaminase (Escherichia coli K-12 substr. MG1655)
Cytidine deaminase. [EC: 3.5.4.5]; 3.5.4.5 [EC: 3.5.4.5]

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

• superpathway of pyrimidine ribonucleosides salvage (10/10 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (6/6 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
• pyrimidine deoxyribonucleosides degradation (3/3 steps found)
• pyrimidine ribonucleosides salvage I (3/3 steps found)
• pyrimidine ribonucleosides degradation (2/2 steps found)
• pyrimidine ribonucleosides salvage II (2/2 steps found)
• pyrimidine deoxyribonucleosides salvage (4/5 steps found)
• superpathway of pyrimidine ribonucleosides degradation (2/5 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Sequence Analysis Tools

See A0A3A4D0M7 at UniProt or InterPro

Protein Sequence (295 amino acids)

>DZA65_RS08940 cytidine deaminase (Dickeya dianthicola ME23)
MQARFHDAFTPLPAALQAALAPILARDDFAAMLSADDVRAICAQCRLDADSLAFALLPLA
AACALTPVSHFHVGAIAQGVSGAFYWGANMEFDGMPLQQTVHAEQSAISHAWLRDEPALR
AVTVNYTPCGHCRQFMNELNSAPALRICLPGRSPALLGHYLPDAFGPRDLAIDTLLMDDI
DNGLTLTTDDTLRQLALAAANRSHAPYSKAFSGIALETRRGRRYAGRYAENAAFNPSLPP
LQAALNLVNLAGEAFNDIQRAVLVESSHVALSQWSLAQPLLASFGCADVCRERAH