Protein Info for DZA65_RS08925 in Dickeya dianthicola ME23

Annotation: molybdopterin-synthase adenylyltransferase MoeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details TIGR02355: molybdopterin synthase sulfurylase MoeB" amino acids 9 to 248 (240 residues), 420.3 bits, see alignment E=1e-130 PF00899: ThiF" amino acids 13 to 246 (234 residues), 267.6 bits, see alignment E=3.8e-84

Best Hits

Swiss-Prot: 70% identical to MOEB_SALTY: Molybdopterin-synthase adenylyltransferase (moeB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11996, adenylyltransferase and sulfurtransferase (inferred from 97% identity to ddd:Dda3937_03739)

MetaCyc: 71% identical to molybdopterin-synthase adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11361 [EC: 2.7.7.80]

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeB" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYI3 at UniProt or InterPro

Protein Sequence (252 amino acids)

>DZA65_RS08925 molybdopterin-synthase adenylyltransferase MoeB (Dickeya dianthicola ME23)
MLPELTDEETLRYNRQIVLRGFDFDAQERLKAAQVLIVGLGGLGCAAAQYLASAGVGRLT
LLDFDTVSLSNLQRQVLHRDDRIGMAKVESARLTLQGINPHVHITPVQHNLDDDALLALV
MQHDAVVDCTDNVSIRDRLNRLCFMQKTPLVSGAAIRMEGQISVFTYQPAEPCYRCLSRL
FGDSALTCVEAGVMAPLVGVIGSLQALETIKLLTHYGQPLAGKLLLFDAMTMQFREMRLP
KNPDCDICGPAT