Protein Info for DZA65_RS08830 in Dickeya dianthicola ME23

Annotation: type VI secretion system tip protein VgrG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 TIGR03361: type VI secretion system Vgr family protein" amino acids 9 to 518 (510 residues), 659.4 bits, see alignment E=3.6e-202 TIGR01646: Rhs element Vgr protein" amino acids 22 to 501 (480 residues), 495.4 bits, see alignment E=2.1e-152 PF05954: Phage_GPD" amino acids 30 to 327 (298 residues), 324.1 bits, see alignment E=1.3e-100 PF04717: Phage_base_V" amino acids 384 to 450 (67 residues), 52.6 bits, see alignment E=7.1e-18 PF22178: Gp5_trimer_C" amino acids 469 to 574 (106 residues), 94.1 bits, see alignment E=9.8e-31

Best Hits

Swiss-Prot: 89% identical to VGRGA_DICD3: Putative type VI secretion system protein VgrGA (vgrGA) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 93% identity to dze:Dd1591_2559)

Predicted SEED Role

"VgrG-3 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWC8 at UniProt or InterPro

Protein Sequence (618 amino acids)

>DZA65_RS08830 type VI secretion system tip protein VgrG (Dickeya dianthicola ME23)
MANSTGLQFTVKVGALPETTFAVVDFELSEALNQPFALSLNLASSQADIDFGAVLDQPCE
LRVWYEGELQRRVSGIVSRFAQGDTGFRRTRYQAEVRPALWRLGLRTNARLFQTRKPDAI
ISTLLEEAGITDFAFALRHDHAAREYCVQYRESDLAFIHRLAAEEGLFYFHEFEAGKHRV
VFADDAGALSKGPELFFNLATQGLSEGAYVRRFRYAEAVSTAEVALKDYSFKTPAYGLLH
NRMSSELDHQRESYQHFDYPGRFKQDPSGKAFTGYRLDALRAGAMTGAGESNAAALMPGS
SFTLTEHPNAAFNLAWQVVAVTHSGQQPQALEEESGGEPTTLSNRFEVVKATTTWRAAMP
YKPRVDGPQIATVVGPAGEEIYCDQYGRIKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVVVSFLEGDPDQPIVTGRTFHATNPSPYPLPANKTRTSLRTRTHKGAGF
NELRFEDQAGQEEVFIHAQKDMNTVVLNNRSTAVNASHSENVGGDQTVVVQHNQTVSIEQ
NQHTGIKGTQNINVGNGRQTSVTTTDTLTVSGDVTVVSTGGNIRLSTAGGYISIDHAGDI
SIVGNHLMLNGVRIDLNQ