Protein Info for DZA65_RS08795 in Dickeya dianthicola ME23

Annotation: MBL fold metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00753: Lactamase_B" amino acids 96 to 298 (203 residues), 78.5 bits, see alignment E=7e-26 PF12706: Lactamase_B_2" amino acids 105 to 256 (152 residues), 29 bits, see alignment E=8e-11

Best Hits

KEGG orthology group: None (inferred from 93% identity to ddc:Dd586_1428)

MetaCyc: 46% identical to methyl parathion hydrolase (Pseudomonas sp. WBC-3)
Aryldialkylphosphatase. [EC: 3.1.8.1]

Predicted SEED Role

"Beta-lactamase-like"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.8.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWB3 at UniProt or InterPro

Protein Sequence (327 amino acids)

>DZA65_RS08795 MBL fold metallo-hydrolase (Dickeya dianthicola ME23)
MKFSTISSRTLLAVSLAFAGTFVAVAPAQAAAPMQHKQVAGFYRTMIGDYEVTALHDGSG
SIDSSLLHGDPALIQSLLARSFQNDPKNVSATVQGYLVNTGSKLILIDTGSGGHWGGPTL
GKLMQNLKASGYQPEQVDLVLLTHLHADHAGGIYKNEKRVFPNATVMMDKADADFWLSKD
IMAKAPEDAKIFFTVAQDAAAPYIAAGKWKPFEGMDEIVPGIAPNAIPGHTPGHTGYMIS
SKGQSLLVWGDCAHVMAVQMPHPEVSIVFDSDSASAVKTREALLVKLAADKTMIGAAHMP
FPGLGRVRQADTGVGYDWVPATFQNLK