Protein Info for DZA65_RS08790 in Dickeya dianthicola ME23

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF10340: Say1_Mug180" amino acids 69 to 209 (141 residues), 34 bits, see alignment E=1.5e-12 PF07859: Abhydrolase_3" amino acids 74 to 271 (198 residues), 155 bits, see alignment E=2.4e-49

Best Hits

KEGG orthology group: None (inferred from 95% identity to ddc:Dd586_1427)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVZ0 at UniProt or InterPro

Protein Sequence (297 amino acids)

>DZA65_RS08790 alpha/beta hydrolase (Dickeya dianthicola ME23)
MTYDPSSIRTLRDAMFASNLVHPVQTIETLRVDMEAISQANPPAADLTIEPTGLGGVAAV
AITAPGASKDRVIYHFHGGGWVAGSPASHLGMLGELSRAAKSQVIVLDHSRAPEHPFPAS
YDESIRGYEAVRALGKPFAVTGDSSGGGMALNALAYASSKGHKDARAALLISPWADLTLT
LPSLTQLADRDPMVNASAMREMVKAYAGNHDLKDPRISPLFADMHGFPPLLIHVGSDEIL
LDDALEIDRKVRAADGESHLEVWPEMLHVWHIQTGSLPQAHDALQRAGEFLIRHLEK