Protein Info for DZA65_RS08720 in Dickeya dianthicola ME23

Annotation: MarR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF12802: MarR_2" amino acids 34 to 92 (59 residues), 35.9 bits, see alignment E=1.3e-12 PF22381: Staph_reg_Sar_Rot" amino acids 34 to 103 (70 residues), 29.4 bits, see alignment E=1.4e-10 PF01047: MarR" amino acids 36 to 93 (58 residues), 36.2 bits, see alignment E=9.2e-13 PF13463: HTH_27" amino acids 55 to 101 (47 residues), 26.8 bits, see alignment E=1e-09

Best Hits

KEGG orthology group: K03712, MarR family transcriptional regulator (inferred from 86% identity to ddc:Dd586_1352)

Predicted SEED Role

"Multiple antibiotic resistance protein MarR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XW25 at UniProt or InterPro

Protein Sequence (156 amino acids)

>DZA65_RS08720 MarR family transcriptional regulator (Dickeya dianthicola ME23)
MNHTTTETLYPIGLLIHLANQFKDNLLTDYFADSDITAPQFKVLISIYKGFTSPVEVSKN
VMMDGGALSRMIERMVKRELIVRQPHPCDKRQVILALTEKGLAIYQHFEQEGMRIVLAQT
TARLTPQEVEQLMRLLTKMLPDDVIARYLRTEFTNN