Protein Info for DZA65_RS08650 in Dickeya dianthicola ME23

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 10 to 36 (27 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 142 to 171 (30 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details PF01925: TauE" amino acids 13 to 250 (238 residues), 161.7 bits, see alignment E=1.3e-51

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 92% identity to ddc:Dd586_1331)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D632 at UniProt or InterPro

Protein Sequence (254 amino acids)

>DZA65_RS08650 sulfite exporter TauE/SafE family protein (Dickeya dianthicola ME23)
MTSLLMANVAVCLILGMGLGVCGGMLGIGGGLIAIPVLGMLFGMNQHLAQGTALIMITPN
VLIGFLRYRQRNKIDTRMTLMLCAFATVSAYFAAHIAATIQVDNLQQAFAIFLLVLATYY
VWQRINSRRSRAPTSVLSPRYLPALGVASGFMSGIFTVGGGLVVVPALVTLFGFTQTQAQ
GIALALVVPGALAALASYTQAGNVDWATGIPLAVGGILSVSWGVALAHKLPVVALRLAFC
LVLVGVAVVMLAGK