Protein Info for DZA65_RS08635 in Dickeya dianthicola ME23

Annotation: iron uptake system protein EfeO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13473: Cupredoxin_1" amino acids 13 to 114 (102 residues), 80 bits, see alignment E=1.3e-26 PF09375: Peptidase_M75" amino acids 134 to 366 (233 residues), 147.9 bits, see alignment E=5e-47

Best Hits

Swiss-Prot: 81% identical to EFEO_YERPN: Iron uptake system component EfeO (efeO) from Yersinia pestis bv. Antiqua (strain Nepal516)

KEGG orthology group: K07224, putative lipoprotein (inferred from 95% identity to ddd:Dda3937_00793)

MetaCyc: 74% identical to ferrous iron transport system protein EfeO (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ferrous iron transport periplasmic protein EfeO, contains peptidase-M75 domain and (frequently) cupredoxin-like domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CW84 at UniProt or InterPro

Protein Sequence (373 amino acids)

>DZA65_RS08635 iron uptake system protein EfeO (Dickeya dianthicola ME23)
MSTSCFRRTALCAALLVLPAFSALAADIAQVKITVNDKQCEPMQVTVAAGKTQFVVTNAS
QKNLEWEILNGVMVVEERENIAPGFTQKMTANLAPGEYDMTCGLLSNPKGKLVVTAGGDA
AAAKTNVLDLVGPIAEYKVYVTKEVDGLVQQTKRFTAAVKAGKLDEARKLYAPTRQHYER
IEPIAELFSDLDGSIDAREDDYEKKADDPKFTGFHRLEKALFADHSTKGMERYADQLYAD
TQELQKRIADLTFPPSKVVGGAAGLIEEVAATKISGEEDRYSRTDLWDFQANVDGAQKIV
NLLRPLLEKANKPLLNKIDANFKTVDGVLAKYQTKDGFESYETLSDADRTALKGPITTLA
EDLAQLRGVLGLD