Protein Info for DZA65_RS08630 in Dickeya dianthicola ME23

Annotation: iron permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 117 to 142 (26 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 219 to 233 (15 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details PF03239: FTR1" amino acids 1 to 268 (268 residues), 266 bits, see alignment E=2.1e-83

Best Hits

Swiss-Prot: 82% identical to EFEU_YERPN: Ferrous iron permease EfeU (efeU) from Yersinia pestis bv. Antiqua (strain Nepal516)

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 94% identity to ddd:Dda3937_00794)

Predicted SEED Role

"Ferrous iron transport permease EfeU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CU30 at UniProt or InterPro

Protein Sequence (281 amino acids)

>DZA65_RS08630 iron permease (Dickeya dianthicola ME23)
MFVPLLIMFREGLEAALIVSLIASYLKRTQRAQWLGAVWVGVALALALCLALGVFINATT
GEFPQKQQELFEGIVAVVAVAMLTYMVFWMRKVSRSVRVHLEGAIDQALSASARQGWALV
AMVFFAVAREGLESVFFLLAAFQQDVGIYAPIGAILGLVCAVVVGMMIYWGGVKLHLARF
FKWSSLFILFVAAGLAAGAIRAFHEAGLWNQFQHIAFDFSATLSTHTLFGTLLEGLFGYQ
ETPTVSEVVVYFLYLIPALAFFFLPPRMEPAATSAARKHHH