Protein Info for DZA65_RS08625 in Dickeya dianthicola ME23

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details PF02743: dCache_1" amino acids 113 to 284 (172 residues), 47.3 bits, see alignment E=3.1e-16 PF22588: dCache_1_like" amino acids 199 to 285 (87 residues), 43.8 bits, see alignment E=3.7e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 349 to 515 (167 residues), 130.5 bits, see alignment E=2.5e-42 PF00990: GGDEF" amino acids 353 to 514 (162 residues), 135 bits, see alignment E=3.1e-43

Best Hits

KEGG orthology group: None (inferred from 91% identity to dze:Dd1591_2785)

Predicted SEED Role

"Putative Heme-regulated two-component response regulator" in subsystem Putative hemin transporter or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CZ46 at UniProt or InterPro

Protein Sequence (519 amino acids)

>DZA65_RS08625 GGDEF domain-containing protein (Dickeya dianthicola ME23)
MSNNNNVQFSALRFLRALPFHISPGITMMAFLVACSLIFVSASIWSFWDSYHHLLVDAEK
NVTNLSVAMSRQAEDTFVPIEVAIDDMLRELSQTGMLDSTRVKSVLDTHRAVLPQLVGFY
LFDEKGNLISSTGKGPLYIYNSGRREYFSWLRENNTASLFIGKVTVSTLTRRRIIPVAKR
INGPNGEFKGVFLATIDHNYFGNFYSYFSLDYNGVLSLMNADGHAIYLYPNREQYINSNF
SDGGLFEQSRLEQGSGSGTWRTTLDNKVRIVGYVKLKRYPLVVAASLDRDALQARWLTEN
MSVMVINIMVLFVMFSLGGFVLKQIRLTVRNKEAISRLHQEESDKNKMLQKLALIDPLTK
LANRRRFDLYLEQSLTLAREEGGPLSLIMLDVDFFKRYNDTYGHVLGDRCLTQLGSVLNG
LPLPTGALTARYGGEEFAIILPGMNGEQAAVYGEQVVEEVRRCALPHQASLLPDQVVTVS
VGVYSHSSDNPCNIQRLKEGADQALYLAKKKGRDYCVRL