Protein Info for DZA65_RS08480 in Dickeya dianthicola ME23

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF05368: NmrA" amino acids 11 to 233 (223 residues), 66.9 bits, see alignment E=3.6e-22 PF13460: NAD_binding_10" amino acids 18 to 149 (132 residues), 60 bits, see alignment E=4.3e-20

Best Hits

KEGG orthology group: None (inferred from 78% identity to reu:Reut_C6067)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XW57 at UniProt or InterPro

Protein Sequence (294 amino acids)

>DZA65_RS08480 SDR family oxidoreductase (Dickeya dianthicola ME23)
MPNYLSSQTRKPRVALAGATGRVGTTLTTLLAADPIDVVVLTRDPNAARLPAGIDAVKVD
FTRVDGLCAALRGVDRLFISHGTSTEQIANEIALIDAAVTAGVQHIVKLSALGPATRLLP
IAWHMQIEAHLARQPIASTVLRPTAFSDVLKRLGPLIAAGSWTGAAGNGRVNFIDTRDIA
DVARIALLEEIEPESQRAYHLTGPRAWTMTEVAEELTRLLGHPVTYVHISPAQQREALLG
SGLSSFTTDLLLGLDRLFRESAIGETTLTVEEITGKAPRSLTEWLTDNLTIFQR