Protein Info for DZA65_RS08400 in Dickeya dianthicola ME23

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 PF00005: ABC_tran" amino acids 26 to 184 (159 residues), 95.2 bits, see alignment E=1.9e-30 amino acids 325 to 475 (151 residues), 106 bits, see alignment E=9e-34 PF08352: oligo_HPY" amino acids 235 to 267 (33 residues), 28.7 bits, see alignment (E = 5e-10) amino acids 527 to 562 (36 residues), 37.5 bits, see alignment 9.2e-13

Best Hits

Swiss-Prot: 60% identical to GSIA_SALPA: Glutathione import ATP-binding protein GsiA (gsiA) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_02992)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XW30 at UniProt or InterPro

Protein Sequence (597 amino acids)

>DZA65_RS08400 ABC transporter ATP-binding protein (Dickeya dianthicola ME23)
MNQPVLRIEQLNTAFRVNGEWLNVVQDLSFEIGERETVALVGESGSGKSVTALSIMRLLA
GPQVRTTGRALFDGRDLLALPAREMQHIRGNRIGMVFQEPMTSLNPVLKIGTQITEVLRR
HRGMDHAGARAEAVRLLEKVRIPAARSRLDEYPLSFSGGMRQRVVIAIALACHPRLLIVD
EPTTALDVTIQAQILALIKTLQDEEGMSILFITHDMGVVAEVADRTMVMYHGAGVEMADT
RRLFRAPQHPYSKTLFSALPRLGDMADSRLPRRFALFGQSAAASAPLADTVTPGEPVLAV
RGLIKRFEVKSGWLRRVTGRVHAVENVSFSLQPGETLSLVGESGCGKSTAGRAILRLLEP
NGGAVSLCGENMLAAGASALAGLRMRAQMIFQDPYDSLNPRLTVGCAIAEPMISHGLASA
RQARQKVAELLEKVGLQADMAERYPHQFSGGQRQRLCIARALALNPRVIIADEAVSALDM
TVKAQIVNLLLDLQQQLGLAYLFISHDMAVVERISHRVAVMYQGEIVEIGPRQAVFNDPQ
HPYTRRLLAAVPVPDPEKRVRRSMQADELHSPLHPADYQPPARRYQQVGDGHLVLLS