Protein Info for DZA65_RS08340 in Dickeya dianthicola ME23

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 PF05935: Arylsulfotrans" amino acids 137 to 383 (247 residues), 79.2 bits, see alignment E=4.6e-26 PF14269: Arylsulfotran_2" amino acids 154 to 398 (245 residues), 54.4 bits, see alignment E=2.1e-18 PF00085: Thioredoxin" amino acids 512 to 593 (82 residues), 38.1 bits, see alignment E=2e-13

Best Hits

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_03005)

Predicted SEED Role

"putative PQQ enzyme repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0N3 at UniProt or InterPro

Protein Sequence (597 amino acids)

>DZA65_RS08340 thioredoxin (Dickeya dianthicola ME23)
MGHPSVYPTGTTIYHPDKAWGGYTVFQALETGAVLIDMNGAALRLWEGLHGFPNKILPGG
YILGHSGQRDARYGMQDMVDVVQLDWDGNRVWQFNRYEHISDPDLPPEWMARAHHDYQRS
GNPVGYYAPGLEPQALGGNTLILAHQNLHNPKISDKLLLDDTIIEVDWQGNILWEWRCSD
HFDELGFDDAAKTALYHNPNMRSSGGGMGDWMHINSMSTLGPNPWFDQGDARFHPDNIIW
DARESNIIAIIDKQSGDIVWRLGPDYSTPELKHLGWIIGQHHAHMIPAGLPGAGNILLFD
NGGWAGYGAPNPASADGVKNAWRDYSRVLEINPVTLDIVWRYSPYEAGIPHPTDAFRFYS
PYISNIQRLPNGNTLINEGANGRLFEVTADHEIVWEYISPFWGKSVNTNMLYRAYRVPYD
WVPQLPRPQETPVQAPDNTRLRQPGAAPAGFASVVAVSDARPYKRGGDALCVATDSEELK
RSPKLFAVNPHRFTALSLAPDETLSLPAGDQLLLVGAERCVHCKSLYRQLETVIADTAFD
GLSCHYLDADHHVPHAAQLQVRSLPTLLWLKDGQEQARLTGAQSADTLRQWLSAILR