Protein Info for DZA65_RS08285 in Dickeya dianthicola ME23

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF09084: NMT1" amino acids 64 to 256 (193 residues), 71 bits, see alignment E=2.1e-23 PF12974: Phosphonate-bd" amino acids 83 to 192 (110 residues), 29.2 bits, see alignment E=9.4e-11 PF13379: NMT1_2" amino acids 141 to 269 (129 residues), 27.6 bits, see alignment E=3.9e-10

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 95% identity to ddd:Dda3937_03017)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C285 at UniProt or InterPro

Protein Sequence (335 amino acids)

>DZA65_RS08285 ABC transporter substrate-binding protein (Dickeya dianthicola ME23)
MKQTGKHGLLSGLLALMMFWHAGAQAASATEIRIAVSDIGAGSQPSGGGLVDLIFSQKRL
EREFARDGISVRWLFIKGAGPVINEGFANHQIDMAYLGDLASIIGRSRGLDSVVIGAAAR
GVNHYLAVSRGSPIHRLEDLKGKQVGLFRGTAAELSFVTALHSRGLSESDMKIINLDFAA
ASAALAAGQIDATWGGSNALALRDKGLADIAVSTRDLQGAGQLSGLILVAGDFARQNQDV
LARIIKVQKEASAWASQPTNRDNYIQLLATQSGYPEPLLREDLDGMPPLSHLLSPELDPA
FVAILKQSVALAYEAKLIRKSFSVEAWLDGAFLKR