Protein Info for DZA65_RS08275 in Dickeya dianthicola ME23

Annotation: MotA/TolQ/ExbB proton channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 117 to 141 (25 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details PF01618: MotA_ExbB" amino acids 94 to 197 (104 residues), 118.7 bits, see alignment E=7e-39

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 98% identity to ddd:Dda3937_03019)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CD56 at UniProt or InterPro

Protein Sequence (232 amino acids)

>DZA65_RS08275 MotA/TolQ/ExbB proton channel family protein (Dickeya dianthicola ME23)
MTLEHIALLSPEGGVILLLLFFSLVTWSIGLLKLAQYARQRRRNQQFRQRFWQQENIDAA
LRDAAHPGALANLARATQLTLERVKDRITPIAHLQDRVERALQQQIQRERRSLENGLALL
ASIGTTSPFIGLFGTVWGIMAALQTIGQSGSASLDTVAGPIGNALIATGIGIAVAVPAVL
IYNYFLRRLKLEVADMDDFAHDIYSVAQAQEFRLAPEQPAAPYAVQTIREVV