Protein Info for DZA65_RS08265 in Dickeya dianthicola ME23

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 399 to 418 (20 residues), see Phobius details amino acids 439 to 458 (20 residues), see Phobius details amino acids 463 to 484 (22 residues), see Phobius details amino acids 496 to 515 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 90 to 261 (172 residues), 91.9 bits, see alignment E=2.1e-30 amino acids 351 to 521 (171 residues), 100.6 bits, see alignment E=4.5e-33

Best Hits

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_03021)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C5N1 at UniProt or InterPro

Protein Sequence (527 amino acids)

>DZA65_RS08265 ABC transporter permease (Dickeya dianthicola ME23)
MMPTMPKLTLHPPRPWPSAHLSAACSALLMPLLLVCGWWLASHYDWMSEQILPSPATVAD
SARDFIPQELAPQLRVSLARLAVGLAGGIALGLTLGVLFGLSRTLDRLCMPLFNVLAQIP
TLAWIPLLMLALGIGEALKLVVLIKAVTVPVTLCTCAGIRQTPQTLYELARTLRLPWPTR
LRRLVIPAMLPYVMTGTRLAFSQGWVSLIAVELLASSEGLGYLMVQSRQLFMLDLVFVCI
LAIGAFGLAGEQALQRLERRWIFWPAPVLSRESPAPHAAWHALAGWFLPALLCLLWQLVT
YQRWVHAAFLPAPREVITALLAGLGSGELTSALSASLSRTLAGFALGAGLGCLLGYLLGR
SRIADRLLTPLLSALRSVALFAWLPLLTAWFGLEESAKVVFIALAAFFPALLASYQGVRH
LPPSLLETARVLRLSARQRLRWLTLPAMLPALFSGLRLSLMHAWVGAIGAEYFIASGNGL
GSMMIRAQQLFQSERVIAGVVLIALVSTLFYRLITLAERRLTAWRFR