Protein Info for DZA65_RS08245 in Dickeya dianthicola ME23

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 49 to 357 (309 residues), 249.7 bits, see alignment E=1.9e-78 PF16576: HlyD_D23" amino acids 58 to 270 (213 residues), 77.4 bits, see alignment E=2e-25 PF13533: Biotin_lipoyl_2" amino acids 61 to 107 (47 residues), 38.2 bits, see alignment 1.9e-13 PF13437: HlyD_3" amino acids 170 to 267 (98 residues), 49.7 bits, see alignment E=1.1e-16

Best Hits

KEGG orthology group: None (inferred from 44% identity to atu:Atu3796)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CMY4 at UniProt or InterPro

Protein Sequence (363 amino acids)

>DZA65_RS08245 efflux RND transporter periplasmic adaptor subunit (Dickeya dianthicola ME23)
MNRQQWFLIGPLAIVLASIAGCDDKAAVNPAPRYVLSATALKESAGGMSLAGTVQPRVTS
ALSFQATGRVVSRYVEVGDEVKAGQVLARLDPLALAFAVQSAQASVQDAQAKLQNAVITA
KRQRSLAAVNVTSVESLEEAEQSLTAAQAAVDVAQARRRKASEQLNYAELKAHFDGVITS
VSVETGQTVAAGQAVLQIAYLGERDAVVDLPESQLKDVTLGHRFEVALQMDPAVKWTGEL
REIAPAADAATRMRRVKIAIHDAPEAFRLGTVVTVSPLMARNTDKPLVVPATAILERQQA
HFVWVINPSSLTVSLREIQLMPASQADSVRVLGGLQEGEQIVIAGVNSLQPGQKIRIERT
STL