Protein Info for DZA65_RS08140 in Dickeya dianthicola ME23

Annotation: type II toxin-antitoxin system HicB family antitoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 PF15919: HicB_lk_antitox" amino acids 3 to 128 (126 residues), 171.4 bits, see alignment E=7.9e-55 PF15970: HicB-like_2" amino acids 3 to 64 (62 residues), 41.1 bits, see alignment E=1.3e-14

Best Hits

Swiss-Prot: 50% identical to YO14_BPHC1: Uncharacterized 14.9 kDa protein in rep-hol intergenic region from Haemophilus phage HP1 (strain HP1c1)

KEGG orthology group: None (inferred from 98% identity to dda:Dd703_1324)

Predicted SEED Role

"Antitoxin 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DAB9 at UniProt or InterPro

Protein Sequence (136 amino acids)

>DZA65_RS08140 type II toxin-antitoxin system HicB family antitoxin (Dickeya dianthicola ME23)
MFYPIAIETGDDTHAYGVTVPDLPGCFSAGDTLDEAIANAKDAITGHIELLIEMGQDIPA
VSSVGALAKSPEYTGYTWAVVDIDVTRLMGGVEKINVTLPKSLIDRIDRCVASNPEFKSR
SGFLAQAALERISSIR