Protein Info for DZA65_RS08130 in Dickeya dianthicola ME23

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF00005: ABC_tran" amino acids 20 to 168 (149 residues), 108.8 bits, see alignment E=3.5e-35

Best Hits

Swiss-Prot: 94% identical to CBRD_DICD3: Achromobactin transport ATP-binding protein CbrD (cbrD) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 96% identity to ddc:Dd586_2575)

MetaCyc: 50% identical to ferric enterobactin ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Siderophore achromobactin ABC transporter, ATPase component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D2W0 at UniProt or InterPro

Protein Sequence (267 amino acids)

>DZA65_RS08130 ABC transporter ATP-binding protein (Dickeya dianthicola ME23)
MTAITSRELTLGYASQTIIDNLDIQLPKGKVSVLIGSNGCGKSTLLKSFARLLRPLSGTV
ILNGEDIHRRSTAEVARELAILPQMPDAPEGISVKQLVSLGRYPYQNWLQQWSQEDERMV
NRALVQTGTDQLAERAVDALSGGQRQRVWIAMTLAQDTDVVLLDEPTTFLDLAHQIEVLD
LLRELNRQHGKTIIMVLHDLNLACRYADHMVAVHNRTAFAQGAPAEILDEALVKTVFNLD
CRIIPDPFFHTPLCIPFGREKPCEKRP