Protein Info for DZA65_RS08105 in Dickeya dianthicola ME23

Annotation: AcsA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 PF04183: IucA_IucC" amino acids 182 to 424 (243 residues), 180.5 bits, see alignment E=4.1e-57 PF06276: FhuF" amino acids 470 to 611 (142 residues), 46.5 bits, see alignment E=6e-16

Best Hits

KEGG orthology group: None (inferred from 92% identity to ddd:Dda3937_02849)

MetaCyc: 92% identical to achromobactin synthetase protein A (Pseudomonas syringae pv. syringae B728a)
6.3.2.-; 6.3.2.-; 6.3.2.-; 6.3.2.-

Predicted SEED Role

"Achromobactin biosynthesis protein AcsA @ Siderophore synthetase superfamily, group B"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVR3 at UniProt or InterPro

Protein Sequence (643 amino acids)

>DZA65_RS08105 AcsA protein (Dickeya dianthicola ME23)
MESSAIKTTSHYKDAGRSVMQDLVDCLLAEEFFGAQPLALYTTDEWRRQYGQPAPFGALD
SAARLWRWCSDEREQHHLVAALRPGITQRWEKVPDTTVYAWQQGGDDWRELEPESFMNLV
FAGQHGEEEQAGEGHAGEGNNAKGQALFLDVLNTSVEQTALSREHRIDTDNLLARGNADF
FHVMEQWASLRDRPFHPTAKAKQGLNAQEYRRYVAEFAEPVALNWVAVAKNRLQCGDGIS
DVVDSYPAHYLLPPAEQAALQQELATRGLADTHIALPVHPWQFDHILAVQLGDAFRNGDC
HRLDFSAARYLPTSSLRSMTPCFASADYLKLPMAVYSLGASRYLPAVKMINGGLSEALLR
QARDKDAVLQQRLYLCDEAKWWAFMPPQATLFDEAPRHLSAMVRSYPSTLFDDPDYRLLP
MAALGTPLPGSRRHFFDDWLAYRGLPTNTDSVLTLFAELCHCFFDINFRMFRLGMLGEIH
GQNAVLVWKAGQAHGLLLRDHDSLRIHVPTLEQNGMQDPVYRIKQGHANTLYHERLDDLL
FWLQTLGIQVNLRAIIDTLSLTYEVEAATLWGVMRGEINGAIDRAGFAADTQTMLKTRLF
DVPNWPQKLLITPMIARAGGPGSMPFGKGEVINPFQSIIVNKQ