Protein Info for DZA65_RS08100 in Dickeya dianthicola ME23

Annotation: siderophore biosynthesis protein SbnG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF03328: HpcH_HpaI" amino acids 26 to 235 (210 residues), 114.2 bits, see alignment E=2.8e-37

Best Hits

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 94% identity to dze:Dd1591_2673)

Predicted SEED Role

"Achromobactin biosynthesis protein AcsB, HpcH/HpaI aldolase family"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XY18 at UniProt or InterPro

Protein Sequence (258 amino acids)

>DZA65_RS08100 siderophore biosynthesis protein SbnG (Dickeya dianthicola ME23)
MLRTNHLKRKLAAGTPVYGLIASIPSPVSVELVAEAGFDFVIIDSEHVLINPETVENMIR
VAESYALTPLVRVADANPKTMLRLLDGGAQGIVLPMVEQAEQVRAAVRACYYHPQGERSL
NSGRPGAFGKHSLAEYVALANREIMLTAMIESAEGVRQAEAIAAVAGLDMILEGAADLSQ
SLGIPWQTAAAPVQAALAEVQRAADAHGVTYCAIPRQHDDHARWREQGVRAFVLGDERGI
AFRALQARLAATISAEGM