Protein Info for DZA65_RS08095 in Dickeya dianthicola ME23

Annotation: achromobactin biosynthetic protein AcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 PF04183: IucA_IucC" amino acids 157 to 405 (249 residues), 259.5 bits, see alignment E=3.1e-81 PF06276: FhuF" amino acids 429 to 601 (173 residues), 134.7 bits, see alignment E=4.4e-43

Best Hits

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_02851)

Predicted SEED Role

"Uncharacterized siderophore S biosynthesis protein, AcsC-like @ Siderophore synthetase superfamily, group C @ Siderophore synthetase component, ligase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWD7 at UniProt or InterPro

Protein Sequence (618 amino acids)

>DZA65_RS08095 achromobactin biosynthetic protein AcsC (Dickeya dianthicola ME23)
METLSPAVFQDIACDWLSHMDAQRYQRVEQRVVGQLLQTLLYEDVLPYRRTPVGDGNSQF
VITGRDAQQVPVEYRCSGLLSDSFELIRLDYASLRRIGPDGDAQSPNLHQMLAELLGEQE
NNPFLTRFVQELEQTQLKDLQSRAQPYQPGKPAHQLSFDQLERHFMDAHSYHPCYKSRIG
FSLQDNAQWGPEFGQPFAIVWLALAKNLASANHSSKLDLDDFLQTEFGAARWQAFSEQLA
RQGRKPADYQLVPVHPWQWKNVIAPVFYPELTSGELLYLGDSDDRWQAQQSIRTLANVTE
KTRPYVKLAMSMTNTSSTRILARHTVMNGPIITYWLQQLIDTDQTARNLKFVILGEVAGV
SFDTQPLLATRMAQAYGVMGAIWRESIHQYLQPDEQAVPFNGLSHVEHRYDGGEQAPFID
AWIRQYGLEAWTRQLLQVTVTPIIHMLYAEGIGMESHGQNIVLIVRDGWPQRIALKDFHD
GVRYSPDHLARPAMRPDLVPLPASHAKINRNSFILTDDVDAVRDFTCDSFFFICLAEMAV
FLRQHYSLPEAQFWEITAQVVLRYQAEHPQHRSRYALFDVFAPTYEVEELTKRRLLGDGE
RRFKSVPNPLHPFRPSSC