Protein Info for DZA65_RS08070 in Dickeya dianthicola ME23

Annotation: diaminobutyrate--2-oxoglutarate transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 66% identical to DAT_HAEIN: Diaminobutyrate--2-oxoglutarate aminotransferase (dat) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00836, diaminobutyrate-2-oxoglutarate transaminase [EC: 2.6.1.76] (inferred from 96% identity to ddd:Dda3937_02856)

MetaCyc: 69% identical to diaminobutyrate--2-oxoglutarate transaminase monomer (Acinetobacter baumannii AYE)
Diaminobutyrate--2-oxoglutarate transaminase. [EC: 2.6.1.76]

Predicted SEED Role

"Achromobactin biosynthesis protein AcsF; Diaminobutyrate--2-oxoglutarate aminotransferase (EC 2.6.1.76)" (EC 2.6.1.76)

MetaCyc Pathways

ectoine biosynthesis (3/5 steps found)
norspermidine biosynthesis (3/6 steps found)
ectoine degradation (1/4 steps found)
superpathway of polyamine biosynthesis III (3/8 steps found)
rhizobactin 1021 biosynthesis (1/7 steps found)
pyoverdine I biosynthesis (2/11 steps found)
baumannoferrin biosynthesis (1/11 steps found)

KEGG Metabolic Maps

Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZ75 at UniProt or InterPro

Protein Sequence (467 amino acids)

>DZA65_RS08070 diaminobutyrate--2-oxoglutarate transaminase (Dickeya dianthicola ME23)
MTDHAQRSNGAQRTGVQRTNADYLERQGWFESNVRSYPRKLPLVIQQAQGVWVTDVDGNQ
YLDCLAGAGTLALGHNHPEVVAGIQAFLASGLPMHTLDLTTPLKDAFCETLLAQLPGGDN
QYCLQFCGPSGADAVEAALKLAKTYTGRGGIVSFSGGYHGMTHGALAVTGNTGPKDAVQN
LMPGVQFLPYPHEYRCPLGIGGDAGVQALSHYFTTFIEDVERGMSLPAAVIVEAVQGEGG
VNPAPVSWLQTLREVTRRHGILLIVDEVQAGFARTGSMFAFEQAGIEPDIIVMSKAVGGG
LPMAVLGIRREFDVWKPGTHTGTFRGNQMAMATGKTTIEILLRDKLAAQAAARGDWLQQQ
FSQLQTRFPCLGQVRGRGLMLGIEIVDERQPAQAGGCYPLDAELAAAIQQHCFRQGLLLE
RGGRQGNVVRLLPPLIITEEQCRSVVERFERAVIDAVTQVRHSSCLG