Protein Info for DZA65_RS08050 in Dickeya dianthicola ME23

Annotation: type I-C CRISPR-associated protein Cas7/Csd2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR01595: CRISPR-associated protein, CT1132 family" amino acids 3 to 277 (275 residues), 301.1 bits, see alignment E=8e-94 PF05107: Cas_Cas7" amino acids 5 to 277 (273 residues), 363.1 bits, see alignment E=4.1e-113 TIGR02589: CRISPR-associated protein Cas7/Csd2, subtype I-C/DVULG" amino acids 6 to 289 (284 residues), 406.7 bits, see alignment E=5.5e-126

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_02860)

Predicted SEED Role

"CRISPR-associated protein, Csd2/Csh2 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DP81 at UniProt or InterPro

Protein Sequence (292 amino acids)

>DZA65_RS08050 type I-C CRISPR-associated protein Cas7/Csd2 (Dickeya dianthicola ME23)
MSLNHRYEFVLLFDVKDGNPNGDPDAGNLPRVDAETGQGLVTDVCLKRKIRNYVGLTRNE
QPPYEIYIKEKAILNKTHERAYEGIGKSEALNSDKKRKGGDAVDEARQWMCRNFYDVRTF
GAVMSIGVNCGQVRGPVQLTFSRSIDPIVALEHTITRCAVATEKEAQAQDGDNRTMGRKN
TVPYGLYRCHGYISAHLARQTGFSDSDLALLWEALINMFEHDRSAARGEMNACALYVFEH
EGELGNAPARKLFDCLHITRTSDGPARRYSDYQVTLDDAALPAGVTLHRLLE