Protein Info for DZA65_RS08030 in Dickeya dianthicola ME23

Annotation: phosphonate ABC transporter, permease protein PhnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 67 to 72 (6 residues), see Phobius details amino acids 75 to 75 (1 residues), see Phobius details amino acids 80 to 80 (1 residues), see Phobius details amino acids 86 to 113 (28 residues), see Phobius details amino acids 141 to 165 (25 residues), see Phobius details amino acids 203 to 219 (17 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 24 to 280 (257 residues), 249.5 bits, see alignment E=1.8e-78 PF00528: BPD_transp_1" amino acids 106 to 280 (175 residues), 34.6 bits, see alignment E=7.9e-13

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 96% identity to ddd:Dda3937_04102)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE1 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVJ5 at UniProt or InterPro

Protein Sequence (297 amino acids)

>DZA65_RS08030 phosphonate ABC transporter, permease protein PhnE (Dickeya dianthicola ME23)
MTPLTPADIAAMKQQHPALFSQQRRYVWRIGLMAAAVLLYYLAFLAFFGISAEQWLRGFS
ELGRYFLHMFVWHDFLNWPFGYYLSQVFITIAIVFAGTLTATLVALPLSFLAARNVMYAP
MLRPVALLVRRLLDILRGIDMAIWGLIFVRAVGMGPLSGALAILMQDTGLLGKLYAEGHE
AVERSPSRGLGAVGANSLQKHRFGIFTQSFPTFLALSLYQMESNVRSAAVLGFVGAGGVG
LVYAENMRLWNWDVVMFITLILVVVVMLMDVLSAHLRQRYIIGKPLPLFESEPPSQH