Protein Info for DZA65_RS08025 in Dickeya dianthicola ME23

Annotation: phosphonate ABC transporter, permease protein PhnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 230 to 246 (17 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 16 to 282 (267 residues), 273.2 bits, see alignment E=1e-85 PF00528: BPD_transp_1" amino acids 111 to 278 (168 residues), 65.8 bits, see alignment E=2.2e-22

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 96% identity to ddd:Dda3937_04101)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE2 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0H4 at UniProt or InterPro

Protein Sequence (287 amino acids)

>DZA65_RS08025 phosphonate ABC transporter, permease protein PhnE (Dickeya dianthicola ME23)
MNPDFERYYQRIRTRQKRESLIWTLLLTVLYIGAGALSEFNLHTLWTSLPHFFDYLIETL
PVLHWSLLFADGHTEGSLAYWGYRLTIQLPLIWETLNLALAATLLSVAASVVLGFVAAGN
TRSPPGVRFAIRALVAFLRTMPELAWAVMFVMAFGIGVIPGFLALALHTIGSLTKLFYEA
IETASERPVRGLAACGASVLQRMRFGLWPQVKPTVLSYSFMRLEINFRQSTILGLVGAGG
IGQELMTNIKLDRYDQVSMTMLLIIVVVSILDALSGRLRRQVVEGGK