Protein Info for DZA65_RS07960 in Dickeya dianthicola ME23

Annotation: phosphonate C-P lyase system protein PhnH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF05845: PhnH" amino acids 6 to 189 (184 residues), 206 bits, see alignment E=2.3e-65 TIGR03292: phosphonate C-P lyase system protein PhnH" amino acids 7 to 187 (181 residues), 171.7 bits, see alignment E=6.8e-55

Best Hits

Swiss-Prot: 53% identical to PHNH_ECOLI: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH (phnH) from Escherichia coli (strain K12)

KEGG orthology group: K06165, PhnH protein (inferred from 95% identity to ddd:Dda3937_04089)

MetaCyc: 53% identical to carbon-phosphorus lyase core complex subunit PhnH (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PhnH protein" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVV4 at UniProt or InterPro

Protein Sequence (191 amino acids)

>DZA65_RS07960 phosphonate C-P lyase system protein PhnH (Dickeya dianthicola ME23)
MTLLAGFSHPWRDAQYAFRRILKAMSEPGVVVSLNHDIGWDGLSPSATAVALTLMDRETP
LWLDPALSQEALLTNLRFHTGVKLVEREAAAFALLPVSRELSLAGFAAGDEMAPENSVTL
VLEVPALGGGRTLRLTGPGIAEARMIAPQLPASVRDYLEQRPHPFPAGLDFIFTCGGTLM
ALPRTTHVEVC