Protein Info for DZA65_RS07950 in Dickeya dianthicola ME23

Annotation: phosphonate metabolism transcriptional regulator PhnF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR02325: phosphonate metabolism transcriptional regulator PhnF" amino acids 9 to 239 (231 residues), 269.6 bits, see alignment E=1.2e-84 PF00392: GntR" amino acids 12 to 73 (62 residues), 70.9 bits, see alignment E=5.6e-24 PF07702: UTRA" amino acids 94 to 233 (140 residues), 106.5 bits, see alignment E=1e-34

Best Hits

Swiss-Prot: 70% identical to PHNF_ECOLI: Probable transcriptional regulator PhnF (phnF) from Escherichia coli (strain K12)

KEGG orthology group: K02043, GntR family transcriptional regulator, phosphonate transport system regulatory protein (inferred from 97% identity to ddd:Dda3937_04087)

Predicted SEED Role

"Transcriptional regulator PhnF" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CUZ6 at UniProt or InterPro

Protein Sequence (239 amino acids)

>DZA65_RS07950 phosphonate metabolism transcriptional regulator PhnF (Dickeya dianthicola ME23)
MDRLSRHPTTVYQAIADRLEQELRTVYRCGDYLPSEQQLAARYEVNRHTLRRAVDELVNK
GLVQRRHGVGILVLMRPYDYPLHAQARFSQNLLEQGSHPTSERLLAVLRPANADVAAALG
REEGDEVIHLRTLRRVNGVPVSVIDHYLPELDWWPALQRFTSGSLHDFLARELQQSLTRR
QTRISARASQAKEAQLLEVARQTPLMCIRTLNICSGSDRVAEYSVSLARADMIELTMEH