Protein Info for DZA65_RS07910 in Dickeya dianthicola ME23

Annotation: D-cysteine desulfhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01275: pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family
  • amino acids 9 to 328 (320 residues), 324.8 bits, E=3.2e-101
• PF00291: PALP
  • amino acids 10 to 319 (310 residues), 181.7 bits, E=1.1e-57

Best Hits

Swiss-Prot: 59% identical to CUYA_RUEPO: L-cysteate sulfo-lyase (cuyA) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K05396, D-cysteine desulfhydrase [EC: 4.4.1.15] (inferred from 95% identity to ddd:Dda3937_02691)

MetaCyc: 59% identical to L-cysteate sulfo-lyase subunit (Ruegeria pomeroyi DSS-3)
L-cysteate sulfo-lyase. [EC: 4.4.1.25]

Predicted SEED Role

"pyridoxal phosphate-dependent deaminase, putative"

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-serine degradation (3/3 steps found)
• L-tryptophan degradation II (via pyruvate) (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• D-serine degradation (2/3 steps found)
• L-cysteine degradation II (2/3 steps found)
• sulfolactate degradation III (2/3 steps found)
• glycine betaine degradation III (4/7 steps found)
• superpathway of sulfolactate degradation (3/6 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• purine nucleobases degradation II (anaerobic) (13/24 steps found)

KEGG Metabolic Maps

• Cysteine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.15 or 4.4.1.25

Sequence Analysis Tools

See A0A3A4CUA4 at UniProt or InterPro

Protein Sequence (337 amino acids)

>DZA65_RS07910 D-cysteine desulfhydrase (Dickeya dianthicola ME23)
MHLARFPRLSLGHFPTPLEPLPRLSAYLGGPTIYIKRDDATGLATGGNKTRKLEFLLAEA
LQQDADVIITQGATQSNHVRQTIAGAARLGLKTQVLLEKRVDDYGVDYQRSGNVLLDKLL
GGDIVGHLSAGTDMQQAMEALAITLREQGHRPYVIPGGGSSPTGALGYVACAEELLYQSS
QQRLRIDHIVHATGSTGTQAGLVAGLVASHSGIPVLGISVRAPQAKQEENVWQLAQRTWQ
KLGLVGEVPREAVQVNSDYVGQGYGIPTAGTLEALKLAAQLEGILLDPVYSGKALAGLID
LVRKGQFGKDDNVLFIHTGGAAGLFGYRQLFEQQEGW