Protein Info for DZA65_RS07905 in Dickeya dianthicola ME23

Annotation: malate/lactate/ureidoglycolate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF02615: Ldh_2" amino acids 5 to 332 (328 residues), 340.4 bits, see alignment E=5.8e-106

Best Hits

KEGG orthology group: K13574, uncharacterized oxidoreductase [EC: 1.1.1.-] (inferred from 96% identity to ddd:Dda3937_02692)

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.37

Use Curated BLAST to search for 1.1.1.- or 1.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVM6 at UniProt or InterPro

Protein Sequence (340 amino acids)

>DZA65_RS07905 malate/lactate/ureidoglycolate dehydrogenase (Dickeya dianthicola ME23)
MPVFSHDYLRHYLRERLTDAEVNAEVAGLVADNLVESSLKGHDSHGVSMLPRYIAALREG
GLSPHAQAEKTLDAGPMMAFSGQHGFGQVVARQAIAQGIERAQQHGVAVLSLSDAHHLGR
IGAWAEQAAQAGLVSLHFANVYTRPIVMPWQGQQPRFGTNPFCAGIPVAGGSPVILDFAT
SVIAGNKARIAWNEGRSLPPGQIVDHQGQPAVEPRWLMEEPFGALLAFGQHKGSGLALVC
SLLGAALTGGSTERTATGQGKQIINSMLSILIDPERLGGAASYQQEIPALLDWVRQSRPD
GGLLLPGDPEQQAYRQRLANGIFVDDASWRQLTELERQVA