Protein Info for DZA65_RS07900 in Dickeya dianthicola ME23

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF13379: NMT1_2" amino acids 44 to 259 (216 residues), 43.4 bits, see alignment E=1.9e-15

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 94% identity to ddd:Dda3937_04315)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXQ7 at UniProt or InterPro

Protein Sequence (326 amino acids)

>DZA65_RS07900 ABC transporter substrate-binding protein (Dickeya dianthicola ME23)
MLALILGLGASPLAAQAEGSISIAQQFGIGYLILDVVRDQQLIEKQGKQQGLDIKVDWRT
LSGATAINEALLSGALDVASAGVPPMLTLWDRTLGKQNVRAIASLGSMPNYLLSNNPAVK
TLRDLSDRDRIATPAAGVGFQSRTLQIETAKLFGDRDYKRFDNITVSLPHPDANAALIAG
GSEITAHFSSPPFQYQALEHPNVHKILSSYDVLGGPGTFNVLYTTQKFHDENPKTYRAFY
DALKDAADIINANKAAAAETYIRAENSRLPLPLVKRIVEDTEVDFTIVPQRTSVYAEKLH
QLGVLKNKAGSWKDYFFNEIHSQPGS