Protein Info for DZA65_RS07890 in Dickeya dianthicola ME23

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 123 to 147 (25 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 272 (171 residues), 55.5 bits, see alignment E=3.3e-19

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 93% identity to ddd:Dda3937_04123)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DAF5 at UniProt or InterPro

Protein Sequence (288 amino acids)

>DZA65_RS07890 ABC transporter permease (Dickeya dianthicola ME23)
MTTSPPIRPEYQRELAPLAPDARVAPLPRLTRLAQHTVLRRLILVLLLLALWEAAARWQN
NDLMLPGFLQTLRAFCQDWLSGELPQKTAVSLGTLLKGYAIGSLLALLLSTLAVSVQLGR
DLLALLTAMLNPLPAIALLPLALLWFGLGEKSLIFVLVHSVMWPMALNAYSGFLGVSDTL
RMAGRNYGLTGWRYVAHILIPAALPAIISGLKIGWAFAWRTLIAAELVFGASSGKGGLGW
YIFQNRNELYTDRVFAGLASVILIGLLVEGLVFATLERLTIRKWGMQR