Protein Info for DZA65_RS07810 in Dickeya dianthicola ME23
Annotation: hydrogenase maturation peptidase HycI
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to HYCI_ECO57: Hydrogenase 3 maturation protease (hycI) from Escherichia coli O157:H7
KEGG orthology group: K08315, hydrogenase 3 maturation protease [EC: 3.4.-.-] (inferred from 91% identity to ddd:Dda3937_00737)MetaCyc: 64% identical to hydrogenase 3 maturation protease (Escherichia coli K-12 substr. MG1655)
RXN-22655 [EC: 3.4.23.51]
Predicted SEED Role
"Coenzyme F420 hydrogenase maturation protease (EC 3.4.24.-)" in subsystem Coenzyme F420 hydrogenase or Hydrogenases (EC 3.4.24.-)
MetaCyc Pathways
- NiFe(CO)(CN)2 cofactor biosynthesis (7/10 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.4.-.-, 3.4.24.-
Use Curated BLAST to search for 3.4.-.- or 3.4.23.51 or 3.4.24.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385XVL7 at UniProt or InterPro
Protein Sequence (165 amino acids)
>DZA65_RS07810 hydrogenase maturation peptidase HycI (Dickeya dianthicola ME23) MTEYPLHTEAPLYIENMVLTVGNTLMGDDGAGPLLAERMSQQPVAGWSVIDGGAIPENAA HTLRELKPRRLLVVDATDMGLTPGEIRIVDPDRIAEDMLMNTHSLPLNYLIDSLKEDIPE VIFVGIQPALVAFYFPISPEVTRAVDTLYQRLSGWEENGGFEMLA