Protein Info for DZA65_RS07775 in Dickeya dianthicola ME23

Annotation: formate hydrogenlyase transcriptional activator FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 725 PF13185: GAF_2" amino acids 209 to 353 (145 residues), 37.3 bits, see alignment E=1.2e-12 PF01590: GAF" amino acids 210 to 352 (143 residues), 38.1 bits, see alignment E=8.6e-13 PF13492: GAF_3" amino acids 218 to 354 (137 residues), 37.3 bits, see alignment E=1.4e-12 PF00158: Sigma54_activat" amino acids 394 to 560 (167 residues), 243.6 bits, see alignment E=3.5e-76 PF14532: Sigma54_activ_2" amino acids 395 to 565 (171 residues), 64 bits, see alignment E=7.6e-21 PF01078: Mg_chelatase" amino acids 405 to 535 (131 residues), 23.2 bits, see alignment E=1.6e-08 PF07728: AAA_5" amino acids 418 to 537 (120 residues), 33.1 bits, see alignment E=2.1e-11 PF25601: AAA_lid_14" amino acids 566 to 641 (76 residues), 76.8 bits, see alignment E=3.8e-25

Best Hits

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_00743)

Predicted SEED Role

"Formate hydrogenlyase transcriptional activator" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D308 at UniProt or InterPro

Protein Sequence (725 amino acids)

>DZA65_RS07775 formate hydrogenlyase transcriptional activator FlhA (Dickeya dianthicola ME23)
MATRLTDSPSRLSILWQDALLKISQSLLQQRTIPDLLRALDGVSFSVVRFGRVNLILLDP
LHNQMNFYRHDRESGHTQCSEEAILLANGPGGVVWSTQTPLHCDRTHFLRDFPHLTEQPA
YAGLSDYCQLPLRGTHRGLGGVEFLKTDGSRFTDNELDFFQALAGVVALVVETIREREQV
LQEEERLRHERDHLRILVDVTNTVISKLELKALALEVSREIHRFFGIDFIALVLKEGEGE
AQTLKYLATVYPQAGAPKTVQGEVDRAQTLADGVMAQHQPQLVQVTQRPQAGEPRPLSQW
FDNALSHVCLLPLAFGNRTLGVLELAHRSALAVSEADLRLLRQIAARIAIALDNALAYEQ
ITRMKDSLVHENFYLTEQLTEHIHQRSGDEFGEIIGRSVAIRQVLEQVEMVAASDSTVLI
LGETGTGKELIARAIHSLSQRKAQHMVKMNCAAIPSGLLESDLFGHEKGAFTGATSQRQG
RFELADNSTLFLDEVGDIPLELQPKLLRVLQEREIERLGGSKVIPVDVRLIAATNRDLKQ
MVADREYRSDLYYRLNVFPIVIPPLRERPEDIPLLVKFFTRKIARRMNRTIDSIPSDMLR
QLSRLPWPGNVRELENVVERAVILTRGTTLNLHMDELQHHLSPLEVPKPSYRDLTPPPMA
AEPSSGPLDAQEEPERERIIRVLRETNGIVAGPKGAAARLGLKRTTLLSRMQRMGISARE
IEGIS