Protein Info for DZA65_RS07615 in Dickeya dianthicola ME23

Annotation: type IV secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 262 to 264 (3 residues), see Phobius details PF04610: TrbL" amino acids 40 to 251 (212 residues), 147.2 bits, see alignment E=3.1e-47

Best Hits

KEGG orthology group: None (inferred from 98% identity to ddc:Dd586_1456)

Predicted SEED Role

"Integral inner membrane protein of type IV secretion complex (VirB6)" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D075 at UniProt or InterPro

Protein Sequence (342 amino acids)

>DZA65_RS07615 type IV secretion system protein (Dickeya dianthicola ME23)
MSGGMFVGMNNTITDGLQAILRGQTSVYGDMVSIIAVSSFTVFVTYQGYQTLAGKRQTPV
EDVMWDIGRMLLIMTFVLNLDGWLNLAIAAINGLKDGVSGDDNVWSLLDTVWEKAQTIGQ
KLYQQDDSAYVKLNGGVAEILVWGGVIVTLLFGATVNLLAEIIIVLMTTTAPLFIFCLLY
GFLTPMFNNWMKIIFTVILTMMFSALSIRIVINYLNGILDKAVNFADSANIITLGVQCCV
AGVISGVIIWFAAKIAGALGGVAVQATLQGAAMSGLRGLASTSSEAAKPAMKTGAAAARL
AAKGSHAAGTLIATGTGNAISAWQKRAAAIESMKRLNQQRPR