Protein Info for DZA65_RS07510 in Dickeya dianthicola ME23

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF01209: Ubie_methyltran" amino acids 7 to 148 (142 residues), 43.7 bits, see alignment E=1e-14 PF05148: Methyltransf_8" amino acids 30 to 151 (122 residues), 32.4 bits, see alignment E=4.1e-11 PF05175: MTS" amino acids 33 to 154 (122 residues), 43.9 bits, see alignment E=9.2e-15 PF13489: Methyltransf_23" amino acids 36 to 191 (156 residues), 63.6 bits, see alignment E=8.3e-21 PF13847: Methyltransf_31" amino acids 39 to 153 (115 residues), 64.2 bits, see alignment E=5.3e-21 PF13649: Methyltransf_25" amino acids 42 to 141 (100 residues), 81.8 bits, see alignment E=2.2e-26 PF08242: Methyltransf_12" amino acids 43 to 143 (101 residues), 61.7 bits, see alignment E=4.1e-20 PF08241: Methyltransf_11" amino acids 43 to 145 (103 residues), 86.7 bits, see alignment E=6.3e-28

Best Hits

Predicted SEED Role

"5-carboxymethyl uridine and 5-carboxymethyl 2-thiouridine methyltransferase" in subsystem tRNA processing

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVA0 at UniProt or InterPro

Protein Sequence (275 amino acids)

>DZA65_RS07510 class I SAM-dependent methyltransferase (Dickeya dianthicola ME23)
MSKYEDYDAISENYDKTRTAVGIEIVLGYIASLNKERQALQILDAGCGTGNYALELKKHY
PNVWCADFSMGMLSKCQQKFSQRGQQANLLRCDITKLPFRDNSLDVVICNQSLHHLDEPG
RQFKNLAEFLRQAARSLKPDGILLINTITHQQLHDGVWWGDLIKPAVERMKLRFTTDEQL
ETLLKQAGLMVTNRVVALDTIIQQRGYFDQNSLFDKTFRDGDSHFSLLTPDELTEMLCHL
EKMRKRGELETYIRDRDRLRRDIGQFTYYVIGKKE