Protein Info for DZA65_RS07495 in Dickeya dianthicola ME23

Annotation: alanine--glyoxylate aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 240 to 255 (16 residues), see Phobius details PF00266: Aminotran_5" amino acids 4 to 346 (343 residues), 86.8 bits, see alignment E=7.4e-29

Best Hits

Predicted SEED Role

"Serine--glyoxylate aminotransferase (EC 2.6.1.45)" in subsystem Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.6.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVK7 at UniProt or InterPro

Protein Sequence (366 amino acids)

>DZA65_RS07495 alanine--glyoxylate aminotransferase family protein (Dickeya dianthicola ME23)
MINNRNTGPTPLPPDVLTAMAQQPLSHRSNAFREAFSDVTARLAKLVNASEPALLLSCSG
TGGLEASIASIVSTESRILVLSAGSYGDLLARIAGRFTPFMDTMRFVPGETFDLDALRVQ
LMQASYDAVLLTHSESSTGIYHPIPLVIALIKAHSDALVLVDVVSSLGVTPIDMAEWGAD
VMVGATQKGLMAPAGMAVVYLSERSRLTIEQSPIVGHDYMHLRPWLEASRQHGVPYTPAV
NVFQGLAAAVSLIFAEGLPARYRRHQDASIRCRAFFADRDGVRCFAMPEYAGASMTALYL
SDAFSASAIKNRLECEHCVVVSTGLGPLAERVIRIGHMGYFTLDEVDDALQAVAQVIEKE
GGGYGD