Protein Info for DZA65_RS07345 in Dickeya dianthicola ME23

Annotation: NAD(P)H-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 137 to 157 (21 residues), see Phobius details PF02525: Flavodoxin_2" amino acids 3 to 175 (173 residues), 137.3 bits, see alignment E=5.6e-44

Best Hits

KEGG orthology group: None (inferred from 50% identity to pct:PC1_0969)

Predicted SEED Role

"NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2" (EC 1.6.99.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.-

Use Curated BLAST to search for 1.6.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVH9 at UniProt or InterPro

Protein Sequence (190 amino acids)

>DZA65_RS07345 NAD(P)H-dependent oxidoreductase (Dickeya dianthicola ME23)
MKEVLIVSGHPNMDEESFSNRIILECLTHLLPEANTLRLDRAHHHYEFDIGLEQERLKKA
DIIVFQFPMFWYGLPALMKKYIDDVFAHGFAYGSTGTYLKDKTLLVSFTTGGAEADYRYD
GEQRYPVEDFLPFLKNLAWYCGMHWGGMVYSGGLMFLPGQDESIIQEMKRKAEDHARTLA
DNVMRLNLSA