Protein Info for DZA65_RS07295 in Dickeya dianthicola ME23

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00745: 2-dehydropantoate 2-reductase" amino acids 7 to 290 (284 residues), 146.3 bits, see alignment E=6.1e-47 PF02558: ApbA" amino acids 7 to 149 (143 residues), 99.1 bits, see alignment E=2e-32 PF08546: ApbA_C" amino acids 170 to 289 (120 residues), 56 bits, see alignment E=5.5e-19

Best Hits

Swiss-Prot: 53% identical to PANE_MYCTO: Putative 2-dehydropantoate 2-reductase (MT2649) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00077, 2-dehydropantoate 2-reductase [EC: 1.1.1.169] (inferred from 93% identity to eca:ECA1579)

Predicted SEED Role

"2-dehydropantoate 2-reductase (EC 1.1.1.169)" in subsystem Coenzyme A Biosynthesis (EC 1.1.1.169)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.169

Use Curated BLAST to search for 1.1.1.169

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XV58 at UniProt or InterPro

Protein Sequence (296 amino acids)

>DZA65_RS07295 oxidoreductase (Dickeya dianthicola ME23)
MSAHPMIALIGPGAIGTTIAAVLHEVDRTPVLCGRTAHPQLILRHDDGDVVVPGPVLSNP
ATISHPFDLVFIAVKTTQVADSANWLAALCDENTVVCVLQNGVEQKTQLEPFVNGATVLP
SVVWFPAQREPDDSVWLRGKPRLTLPDVPQAKRVADALSGTRCVVELSTDFISIAWRKLL
QNAVAGLMVLANRRAGMFSRVDITELALAYLRECLTVARAEGAVLNDSVPQEIVNGFHHA
PADLGTSILADRQANRPLEWDIRNGVVQRYGHSHGISTPISDVLVPLLAAGSEGPG