Protein Info for DZA65_RS07225 in Dickeya dianthicola ME23

Annotation: proline iminopeptidase-family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR01250: proline-specific peptidase" amino acids 11 to 299 (289 residues), 271.2 bits, see alignment E=6.2e-85 PF00561: Abhydrolase_1" amino acids 36 to 287 (252 residues), 93.5 bits, see alignment E=2.7e-30 PF12697: Abhydrolase_6" amino acids 37 to 291 (255 residues), 62.2 bits, see alignment E=1.7e-20 PF12146: Hydrolase_4" amino acids 37 to 287 (251 residues), 67.3 bits, see alignment E=2e-22

Best Hits

Swiss-Prot: 66% identical to LAAA_PSEFS: L-amino acid amidase (laaA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 94% identity to ddd:Dda3937_00843)

MetaCyc: 66% identical to L-proline amide hydrolase (Pseudomonas azotoformans)
RXN-10757 [EC: 3.5.1.101]; 3.5.1.101 [EC: 3.5.1.101]

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.5 or 3.5.1.101

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVB6 at UniProt or InterPro

Protein Sequence (303 amino acids)

>DZA65_RS07225 proline iminopeptidase-family hydrolase (Dickeya dianthicola ME23)
MYNKYNKYNVCEGYAPFREYRTWYRVCGDLASPLTPLVVAHGGPGCTHDYVDAFRDLAQT
GRAVIHYDQTGNGRSTHLRDKPTGFWQVALFLDELDNLLRHLGIAQRYALLGQSWGGMLA
AEHAVRQPAGLQGVVIANSPASMPLWLSAAARLRAALPPAIQATLLAHEQAGTLDSDAYR
AASQVFYQRHVCRLDPWPDEVKRTFAAMNNDPTVYHAMNGPTEFHVIGSMKDWSIIDRLH
AINVPTLLISGEYDEAAPEVVQPFADRIRNSEWVIFKHSSHMPHVEERAACMAVVGEFLG
RLP