Protein Info for DZA65_RS07145 in Dickeya dianthicola ME23

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF00535: Glycos_transf_2" amino acids 10 to 104 (95 residues), 32.7 bits, see alignment E=3.5e-12 TIGR01556: rhamnosyltransferase" amino acids 13 to 292 (280 residues), 258.9 bits, see alignment E=2.6e-81

Best Hits

Predicted SEED Role

"dTDP-rhamnosyl transferase RfbF (EC 2.-.-.-)" in subsystem dTDP-rhamnose synthesis (EC 2.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CHY0 at UniProt or InterPro

Protein Sequence (302 amino acids)

>DZA65_RS07145 glycosyltransferase family 2 protein (Dickeya dianthicola ME23)
MLTDKSSIFSVIVTYYPKIDNVIDLITELKNQEVTPVVVDNGSLSEDEFSTLSNLCKVIR
LDDNVGIAKAQNVGILYVKEKEGEGILFFDQDSKINNSFVNEIMNDYNLVCSEVGQGKLA
AIGPVFTDSRYGFFYKFIKVSKLGFRKKISPEGFSKPFEVSLIISSGSLLPVSVLDDVGL
MNEDLFIDYVDTEWCLRAVSKGYKVYVATSAKMSHAIGDKMVKFFVFNIPVHSPIRRYYR
IRNALLFSSMPHVPFVLIMRENVFNIVHQLILIISQRKLSYFSIMTKAIHDGLNFSKKNN
AI