Protein Info for DZA65_RS07055 in Dickeya dianthicola ME23

Annotation: iron-sulfur cluster carrier protein ApbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF10609: ParA" amino acids 106 to 349 (244 residues), 334.3 bits, see alignment E=1.1e-103 PF13614: AAA_31" amino acids 108 to 146 (39 residues), 31.5 bits, see alignment 3.9e-11 PF09140: MipZ" amino acids 109 to 231 (123 residues), 31.6 bits, see alignment E=2.8e-11 PF01656: CbiA" amino acids 110 to 229 (120 residues), 36.1 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 79% identical to APBC_ECOL6: Iron-sulfur cluster carrier protein (mrp) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 98% identity to ddc:Dd586_1230)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CH93 at UniProt or InterPro

Protein Sequence (369 amino acids)

>DZA65_RS07055 iron-sulfur cluster carrier protein ApbC (Dickeya dianthicola ME23)
MNDKLPAQNPEMLRAVVNGVLSSFTHPTLKNNLTTLNALHHCALLDDVLHIELTMPFVWL
SGLTDLKDSVSEELLRLCGAREVEWRLTHNVATLRRVNNQAGVKGVKNIIAVSSGKGGVG
KSSTAVNMALALAAEGANVGILDADIYGPSIPTMLGAASERPTSPDGQHMAPIVAHGLAT
NSIGYLVTDDNAMVWRGPMASKALLQLLQDTLWPDLDYLVLDMPPGTGDIQLTLAQNVPV
TGAVVVTTPQDIALMDAMKGIVMFEKVKVPVLGIVENMSVHICSNCGHLEPIFGTGGAQK
LAEKYHCALLGQLPLHISLREDLDRGEPTVVSQPDSEFTQLYRELAGQVAAQLYWQGEVI
PTEIAFRAV