Protein Info for DZA65_RS06920 in Dickeya dianthicola ME23

Annotation: cell division protein CpoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 37 to 110 (74 residues), 77.2 bits, see alignment E=3.8e-25 TIGR02795: tol-pal system protein YbgF" amino acids 155 to 271 (117 residues), 149 bits, see alignment E=4.4e-48 PF13174: TPR_6" amino acids 157 to 187 (31 residues), 24.9 bits, see alignment 1e-08 amino acids 193 to 224 (32 residues), 27.6 bits, see alignment 1.4e-09 amino acids 229 to 261 (33 residues), 35.9 bits, see alignment 3.2e-12 PF13525: YfiO" amino acids 159 to 272 (114 residues), 30.9 bits, see alignment E=1e-10 PF13432: TPR_16" amino acids 161 to 225 (65 residues), 37.1 bits, see alignment E=1.5e-12 PF13181: TPR_8" amino acids 229 to 260 (32 residues), 14.9 bits, see alignment 1.1e-05

Best Hits

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_00558)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CHL6 at UniProt or InterPro

Protein Sequence (274 amino acids)

>DZA65_RS06920 cell division protein CpoB (Dickeya dianthicola ME23)
MSSNFRHHVLSLSLLVGVAAPWAATAQAPISNVGSGSVEDRVTQLERISNAHSQLLTQLQ
QQLADTQRDIDGLRGQIQENQYQLNQVVERQKQIYQQIDSLGSQSGGQSSSAASSAAGAG
NAAASAPAATSDTGAANSASADSAAAPAMTGDVNTDYNTAASLVLEKKQYDQAIAAFQNF
VKKYPDSTYQPNANYWLGQLFYNKGKKDDAAYYFANVVKNYPKSPKASEAMFKVGVIMQE
KGQTDKAKAVYQQVVKNYPNTDGAKQAQKRLAGL