Protein Info for DZA65_RS06855 in Dickeya dianthicola ME23

Annotation: ADP-forming succinate--CoA ligase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01016: succinate-CoA ligase, beta subunit
  • amino acids 1 to 385 (385 residues), 597.9 bits, E=4e-184
• PF08442: ATP-grasp_2
  • amino acids 2 to 203 (202 residues), 274.4 bits, E=8.1e-86
• PF13549: ATP-grasp_5
  • amino acids 3 to 215 (213 residues), 44.5 bits, E=1.9e-15
• PF00549: Ligase_CoA
  • amino acids 262 to 382 (121 residues), 113.3 bits, E=1.4e-36

Best Hits

Swiss-Prot: 95% identical to SUCC_PECCP: Succinate--CoA ligase [ADP-forming] subunit beta (sucC) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01903, succinyl-CoA synthetase beta subunit [EC: 6.2.1.5] (inferred from 99% identity to dze:Dd1591_2912)

MetaCyc: 94% identical to succinyl-CoA synthetase subunit beta (Escherichia coli K-12 substr. MG1655)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• reductive TCA cycle I (8/11 steps found)
• incomplete reductive TCA cycle (5/7 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• pyruvate fermentation to acetate VI (2/3 steps found)
• adipate biosynthesis (3/5 steps found)
• adipate degradation (3/5 steps found)
• reductive TCA cycle II (8/12 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• methylaspartate cycle (8/19 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C5-Branched dibasic acid metabolism
• Citrate cycle (TCA cycle)
• Propanoate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5

Sequence Analysis Tools

See A0A3A4CH30 at UniProt or InterPro

Protein Sequence (388 amino acids)

>DZA65_RS06855 ADP-forming succinate--CoA ligase subunit beta (Dickeya dianthicola ME23)
MNLHEYQAKQLFARYGLPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KLVNSKEEIRAFAENWLGKRLVTYQTDANGQPVHQILVEGATDIDKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPQPYQGRELAFKLGLNGKQVAQFTKI
FMGLAALFLDRDLALVEINPLVITKQGDLICLDGKLGADGNALFRQPELREMRDHSQEDA
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGSPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAQK
LADSGLNIIAATSLTDAAQQVVAAVEGK